PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005193-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 286aa    MW: 31125.8 Da    PI: 8.8509
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005193-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-3949106461
                 zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            + lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  SMil_00005193-RA_Salv  49 HPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRP 106
                            5789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2845105IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3350105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52551105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MLGNCDNKII TPISSTTNQW PQNQIILDDH KSFMASSSTN KVMEKPDPHP LKCPRCDSSN  60
TKFCYYNNYS LSQPRHFCKA CKRYWTRGGT LRNVPVGGGC RKNKRPKRHS DAAAAASQPH  120
MDLPPPLPTI FSLLYDYDPP INPLGLGFSS GLGSAENAFK NGFKPIQEAS SSPFSSPANS  180
NSNSIFFGSS SASTMASLLA STHKFGAPGL IHYEDPGMGK QVKAEGENMH RMAWNPNPNQ  240
NQNPNLNTNP IDQINSSDPS SLVWNTSSVG AWFDPSTMGS SVPSLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554179.11e-101LOW QUALITY PROTEIN: dof zinc finger protein DOF1.4-like
TrEMBLA0A068TVZ02e-73A0A068TVZ0_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00040.t017e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.16e-35Dof family protein