PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005192-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 272aa    MW: 29452.7 Da    PI: 9.9196
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005192-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-393188461
                 zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             +kcprCds+ntkfCyynnyslsqPryfCkaCrryWt+GG+lrnvPvGgg+rk+k+ 
  SMil_00005192-RA_Salv 31 PPQKCPRCDSANTKFCYYNNYSLSQPRYFCKACRRYWTHGGTLRNVPVGGGCRKSKRP 88
                           5689***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.3E-333387IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2083387IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-223482IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEPRRNDQDR LKHQQDHRVK PPETQQMAPP PPQKCPRCDS ANTKFCYYNN YSLSQPRYFC  60
KACRRYWTHG GTLRNVPVGG GCRKSKRPKP SSAPSSSAGE IGRSSQPAIP SQNLTPLNSG  120
QQPMRPFPPI MSSMANTFYS GGSFLSSLAA MQSLSTGISQ APALNLGGGG GGGQYDALLQ  180
GVSLPLKPQP PPPHQFQLQI NDHYFPSQHN LTTPPPRPSW TQSFINRGPA AAATTSAASS  240
SFWTGDGDNQ AGSSFNPNHW QDSNPGFDPS SQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096324.27e-86dof zinc finger protein DOF3.1
TrEMBLA0A2G9GQ552e-86A0A2G9GQ55_9LAMI; Uncharacterized protein
STRINGMigut.M01126.1.p1e-76(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-29TARGET OF MONOPTEROS 6