PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00004677-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 136aa    MW: 15155.9 Da    PI: 9.0493
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00004677-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof105.43.2e-3341101262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +e++l+cprC+stntk+CyynnyslsqPryfCk+Crry t+GG+lrnvP G+g+ knk+ss
  SMil_00004677-RA_Salv  41 NEQTLNCPRCNSTNTKLCYYNNYSLSQPRYFCKTCRRYRTEGGSLRNVPDGSGSCKNKRSS 101
                            68999****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-224099IPR003851Zinc finger, Dof-type
PfamPF027011.2E-274399IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.3324599IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MNEEGEEVLE LRNLQSTTQT QSSKPSNGGA AAAEKKPWSK NEQTLNCPRC NSTNTKLCYY  60
NNYSLSQPRY FCKTCRRYRT EGGSLRNVPD GSGSCKNKRS SPAPPFILAN KPLPDPNFSP  120
QNPKIQEGHD LNLFGL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022887009.15e-40dof zinc finger protein DOF4.6-like
SwissprotQ433859e-30DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A4D8ZWA98e-44A0A4D8ZWA9_SALSN; Uncharacterized protein
STRINGVIT_16s0098g01420.t019e-36(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.17e-32Dof family protein