PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003942-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 534aa    MW: 58194.3 Da    PI: 5.0335
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003942-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-39169229262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk++ 
  SMil_00003942-RA_Salv 169 PDKILPCPRCNSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNAA 229
                            7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-31154226IPR003851Zinc finger, Dof-type
PfamPF027018.2E-32171227IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.882173227IPR003851Zinc finger, Dof-type
PROSITE patternPS013610175211IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
LVYIRKERER ESEIEVEGIM REKMSEVKDP KIKLFGKTIE LPDTASEAAV AAEKAGEAAQ  60
SFDAAGDDDS IQDPPCSSNS MIEENDLNGD AEDQESNKNQ SGLKQDDKEE DQAQPLTSDE  120
LKDSDTTPCI VADPKALSAD SDAGPVQSSK MEEDQTETSN SQDKTLKKPD KILPCPRCNS  180
MDTKFCYFNN YNVNQPRHFC KNCQRYWTAG GTMRNVPVGA GRRKNKNAAS QFRHLTVPNV  240
LQNARVDLQN GIHHPVLSPN GTVITFNSDT PLCESMVSVL NIADKTVRSN LRNGFHRPEE  300
LGMETSHGHK ENGDDHSSGS STTAASSKDE VGKTGLPEPI PNNHPFPPQV PCFPGAPWPY  360
PWHSVQWTAP ISPPNFPPGG FALPFYPTAP PYWGCAVPGP WNVPWIIPPT PSQSHTPPNS  420
GPNSPTLGKH SRDDNTLKPV NPEDASEKES NPEKCLWVPK TLRIDDPGEA AKSSIWATLG  480
IKNERADSVG GGGLFKAFQS QSKGDEKAHA SETSTVLQAN PAALSRSLSF HENS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098639.10.0cyclic dof factor 2-like
TrEMBLA0A4D8Y8A30.0A0A4D8Y8A3_SALSN; Dof zinc finger protein DOF5.5
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-103cycling DOF factor 2