PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003916-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 266aa    MW: 29274.7 Da    PI: 9.3124
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003916-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-392786362
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           +  +kcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  SMil_00003916-RA_Salv 27 DPPVKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 86
                           6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.7E-332984IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-263084IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2363084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSPLPGGKDE SQSSSTRKAS SSSRAQDPPV KCPRCDSPNT KFCYYNNYSL TQPRHFCKTC  60
RRYWTKGGAL RNVPIGGGCR KNKKIKRLPA DSKDSDVPLK FAMDFQLPNP SLSNSSPHSH  120
TPCFNLDPSS LMGFAFPLKQ GQNLGFQEMV HHTNLATSIE SLSSINQDLH WKLQQQRLAT  180
LFVENATHKE ASGNIQFQSL PENPKTDSCL IGTSRKDGSF SNNTDTFLNN SPPTPHPAGN  240
NFNGAAGNWS GGIQAWTELS HYTSLP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763887e-53AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843607e-53AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
GenBankEU9475247e-53EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269777e-53KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
GenBankKJ7269977e-53KJ726997.1 Zea mays clone pUT3969 C2C2-DOF transcription factor (DOF24) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097460.14e-87dof zinc finger protein DOF5.7-like
SwissprotQ9LSL63e-57DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A4D8ZTM82e-92A0A4D8ZTM8_SALSN; Uncharacterized protein
STRINGEOX918923e-75(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.16e-47Dof family protein
Publications ? help Back to Top
  1. Castorina G,Fox S,Tonelli C,Galbiati M,Conti L
    A novel role for STOMATAL CARPENTER 1 in stomata patterning.
    BMC Plant Biol., 2016. 16(1): p. 172
    [PMID:27484174]