PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003463-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 559aa    MW: 62041.7 Da    PI: 4.5417
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003463-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.21.2e-47221491128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtd elv +yLk+k+ gkkl   e+i+ev+iyk+ PwdLp k ++k+++ ew+fF++r+kkya g r +rat++gyWk+t
  SMil_00003463-RA_Salv  22 LPPGFRFHPTDVELVLYYLKRKILGKKLLY-EAIAEVNIYKYSPWDLPdKsSLKSKDLEWFFFCPREKKYACGVRVKRATENGYWKTT 108
                            79*************************888.89**************95346667777****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd+++ + ++++vg  ktL+f+ g+apkge+tdWv+heyr+
  SMil_00003463-RA_Salv 109 GKDRTISC-NEKTVGAVKTLIFHLGHAPKGERTDWVIHEYRV 149
                            ********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5810171IPR003441NAC domain
PROSITE profilePS5100554.93922171IPR003441NAC domain
PfamPF023654.7E-2423149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
LVGVYFSSWI IRCSVVPVSM RLPPGFRFHP TDVELVLYYL KRKILGKKLL YEAIAEVNIY  60
KYSPWDLPDK SSLKSKDLEW FFFCPREKKY ACGVRVKRAT ENGYWKTTGK DRTISCNEKT  120
VGAVKTLIFH LGHAPKGERT DWVIHEYRVV DNQLAEAGVQ DNYVLCKVFK KNGLGPKNGA  180
QYGAPFNEAD WTDDDDNVSE NHAISLAAEG LPQTSGMQNE EQSLPLGSGL FDSGNEPLPI  240
LEDGPSTSAV APNSMVAADK TNDEIVHMLA SFADEDMLLP DGNGFSQDDL GGNGNNRLLS  300
YNEGLDIYNG LHDLDSWTAI NEGIFDFSGS HNVDYPLNML PEDNSTYIEL DDLLPPLDCS  360
NGVTGTPFSS LCRSSASYDH ENMEQLHSRT RFAGMDDQNI SYANELAVLP NTSEGDISLN  420
VLHMVDYPFY QGPNASYNLD FSFGQLENPV CSPHNMERGS HLENLYSRFK ECIPAHLPSA  480
AALSPCGGSS IHIKAEVTHG AGECTNEALA VMMGGSSSCW CNLLFWKIQL WVVEDLLDLR  540
QIVKCQLSVE LQVLVRMEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-462017718174NAC domain-containing protein 19
3swm_B6e-462017718174NAC domain-containing protein 19
3swm_C6e-462017718174NAC domain-containing protein 19
3swm_D6e-462017718174NAC domain-containing protein 19
3swp_A6e-462017718174NAC domain-containing protein 19
3swp_B6e-462017718174NAC domain-containing protein 19
3swp_C6e-462017718174NAC domain-containing protein 19
3swp_D6e-462017718174NAC domain-containing protein 19
3ulx_A9e-462017113168Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099748.10.0NAC domain-containing protein 82-like isoform X1
TrEMBLA0A4D9BV250.0A0A4D9BV25_SALSN; Uncharacterized protein
STRINGMigut.H00727.1.p1e-179(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.48e-89NAC domain containing protein 82