PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003459-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 241aa    MW: 26213.7 Da    PI: 9.8258
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003459-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.1e-403694361
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                            ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  SMil_00003459-RA_Salv 36 PENLRCPRCDSANTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKAT 94
                           57899***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.0E-333893IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-243989IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4133993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
DRSKLSTTTP CGGGGGGILD HASPSPSPPP SSAAAPENLR CPRCDSANTK FCYYNNYNLT  60
QPRHFCKTCR RYWTKGGALR NVPIGGGCRK NKATAIAAKS AAKLRTPPPP PQQSEMALSP  120
IPNPMIWASP QSSHFLSLIR GNPNHLAIKD ETSPNLALHR NQTQFVEAQH HGLQELYHRL  180
RLSPNFYPEI ANSSTILESA PVAVAAAADH MGFWGSNASW AADCRQLTVH ILKRQNPSYV  240
I
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843632e-59AM084363.1 Hordeum vulgare subsp. vulgare partial dof15 gene for dof zinc finger protein 15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554970.17e-57dof zinc finger protein DOF1.1-like
TrEMBLA0A4D9AF329e-65A0A4D9AF32_SALSN; Uncharacterized protein
TrEMBLA0A4D9BVI97e-65A0A4D9BVI9_SALSN; Uncharacterized protein
STRINGcassava4.1_024126m2e-54(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.24e-32Dof family protein