PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003416-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 271aa    MW: 31360.5 Da    PI: 7.7728
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003416-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.2e-54121411128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWka 85 
                            +ppGfrFhPtdeel+ +yLkkkv+ +++++ +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wka
  SMil_00003416-RA_Salv  12 VPPGFRFHPTDEELLYYYLKKKVSYEPIDF-DVIREVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKA 98 
                            69****************************.9***************952444443456***************************** PP

                    NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            tg+dk++  ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  SMil_00003416-RA_Salv  99 TGRDKAIQMSNSRRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 141
                            *****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-619164IPR003441NAC domain
PROSITE profilePS5100558.79212164IPR003441NAC domain
PfamPF023652.0E-2813141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MMGGGNNGAL SVPPGFRFHP TDEELLYYYL KKKVSYEPID FDVIREVDLN KLEPWDLKEK  60
CRIGSGPQNE WYFFSHKDKK YPTGTRTNRA TAAGFWKATG RDKAIQMSNS RRIGMRKTLV  120
FYTGRAPHGQ KTDWIMHEYR LDDDTAPPNE IQEDGWVICR VFKKKNLSRG FHADVEQEDP  180
PISFHALQQD TFNSMHLPQL LSPEQAASFI PMAGPSFIHH DKLSGDWSFL DKLLATQHTM  240
DHITKCQQFP HVPDLLPPTQ RFPFSYHDFS K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-511016615167NO APICAL MERISTEM PROTEIN
1ut4_B2e-511016615167NO APICAL MERISTEM PROTEIN
1ut7_A2e-511016615167NO APICAL MERISTEM PROTEIN
1ut7_B2e-511016615167NO APICAL MERISTEM PROTEIN
3swm_A2e-511016618170NAC domain-containing protein 19
3swm_B2e-511016618170NAC domain-containing protein 19
3swm_C2e-511016618170NAC domain-containing protein 19
3swm_D2e-511016618170NAC domain-containing protein 19
3swp_A2e-511016618170NAC domain-containing protein 19
3swp_B2e-511016618170NAC domain-containing protein 19
3swp_C2e-511016618170NAC domain-containing protein 19
3swp_D2e-511016618170NAC domain-containing protein 19
4dul_A2e-511016615167NAC domain-containing protein 19
4dul_B2e-511016615167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095843.11e-142protein SOMBRERO-like
RefseqXP_011095844.11e-142protein SOMBRERO-like
RefseqXP_020554180.11e-142protein SOMBRERO-like
RefseqXP_020554181.11e-142protein SOMBRERO-like
RefseqXP_020554182.11e-142protein SOMBRERO-like
RefseqXP_020554183.11e-142protein SOMBRERO-like
RefseqXP_020554184.11e-142protein SOMBRERO-like
RefseqXP_020554185.11e-142protein SOMBRERO-like
RefseqXP_020554186.11e-142protein SOMBRERO-like
RefseqXP_020554187.11e-142protein SOMBRERO-like
RefseqXP_020554188.11e-142protein SOMBRERO-like
RefseqXP_020554189.11e-142protein SOMBRERO-like
SwissprotQ9MA171e-105SMB_ARATH; Protein SOMBRERO
TrEMBLA0A2G9HTP41e-147A0A2G9HTP4_9LAMI; Uncharacterized protein
STRINGMigut.M01489.1.p1e-131(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.37e-89NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]