PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003183-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 337aa    MW: 35816.8 Da    PI: 9.5131
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003183-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.5e-3974133362
                 zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            e++lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  SMil_00003183-RA_Salv  74 ETSLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 133
                            6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3457126IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3276131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60977131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVFSSIPAYL DPSNWNQQQN HQIIGSSSAN PLLPPPPHPG GPPPPPPPQP HGGGGIRPGS  60
MAERARMANI PMPETSLKCP RCESTNTKFC YFNNYSLSQP RHFCKTCRRY WTRGGALRNV  120
PVGGGCRRNK RSKSSNSKSP ASSDRQANNN PSSTSTVSTN SNSAAANMLG LTPPLPPLRF  180
MSPLGQFTDN FTADMGLNYS AIAASTVGTS DMNFHGAGSL LGGSGSGGVA SLLSSEGGGI  240
EPWRLQQVQQ FPFLDASSQG FYQFHGGEAG FLGGGEARPK LSSPMMSQRP PVKMEDNNAE  300
NNLTRQILGG NEQWNAPTTA NWTDLSSFSS SSTSNPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935814e-36AB493581.1 Arabidopsis thaliana At2g37590 mRNA for hypothetical protein, partial cds, clone: RAAt2g37590.
GenBankAC0046844e-36AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankBT0300144e-36BT030014.1 Arabidopsis thaliana At2g37590 mRNA, complete cds.
GenBankCP0026854e-36CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095199.11e-134dof zinc finger protein DOF5.1
TrEMBLA0A4D9BAY21e-132A0A4D9BAY2_SALSN; Uncharacterized protein
STRINGEOY075471e-100(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-46DNA binding with one finger 2.4