PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00002624-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 400aa    MW: 44968.4 Da    PI: 9.3424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00002624-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.96.9e-52111391128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWka 85 
                            +ppGfrFhPt+eel+++yLkkkv ++k++l +vik+vd++k+ePwd+++k++     +++wyfFs++dkky+tg+r+nrat sg+Wka
  SMil_00002624-RA_Salv  11 VPPGFRFHPTEEELLQYYLKKKVVSEKIDL-DVIKDVDLNKLEPWDIQEKCRIgttPQNDWYFFSHKDKKYPTGTRTNRATCSGFWKA 97 
                            69****************************.9***************964443122456***************************** PP

                    NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            tg+dk ++  +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  SMil_00002624-RA_Salv  98 TGRDKVIYG-NSTRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                            ********9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-587174IPR003441NAC domain
PROSITE profilePS5100556.14611174IPR003441NAC domain
PfamPF023657.1E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MSISVNGQSQ VPPGFRFHPT EEELLQYYLK KKVVSEKIDL DVIKDVDLNK LEPWDIQEKC  60
RIGTTPQNDW YFFSHKDKKY PTGTRTNRAT CSGFWKATGR DKVIYGNSTR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DNATPNNIAA ASVCNGAGEG GQEEGWVVCR VFKKKSLGHK  180
ASDCSPIGAT WPSPSSMSTM NSCNEASLEE MLQSMGTPSR RDFDTDNNND NNNNNNNNNN  240
DNNNSCNRRY MKLPGLYNSS CRTQTNYYQP LNLQMLGGDE IAADFPTFLS QPPDAIGIQD  300
WAALDRLVAS HLSDAPSKPL HAALSHDSAG SRMTFGCPDD PLLHLQQRLR RRLRADATAS  360
LRRRRRMITR TKAISGASPR RVTISCATCR PFTPSRVSYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-47818017174NAC domain-containing protein 19
3swm_B5e-47818017174NAC domain-containing protein 19
3swm_C5e-47818017174NAC domain-containing protein 19
3swm_D5e-47818017174NAC domain-containing protein 19
3swp_A5e-47818017174NAC domain-containing protein 19
3swp_B5e-47818017174NAC domain-containing protein 19
3swp_C5e-47818017174NAC domain-containing protein 19
3swp_D5e-47818017174NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1347353RLRRRLR
2349365RRRLRADATASLRRRRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093005.11e-152NAC domain-containing protein 43
SwissprotQ84WP61e-113NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A314XZA61e-124A0A314XZA6_PRUYE; Uncharacterized protein
STRINGVIT_15s0048g02660.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-115NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]