PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00002565-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 332aa    MW: 36828.1 Da    PI: 7.9408
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00002565-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.7e-39103162261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  SMil_00002565-RA_Salv 103 PDKIIPCPRCKSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNC 162
                            7899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3090160IPR003851Zinc finger, Dof-type
PfamPF027011.5E-31105161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.612107161IPR003851Zinc finger, Dof-type
PROSITE patternPS013610109145IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MKMLNEPEIK LFGRKIYFPE NGAVGERSGE WSNESSGDCD RCLEQSKGQD GEEVGRKEKQ  60
EQRDEEIAEG EICETSAENE ESDGGSESNT KTENSEQKTL KKPDKIIPCP RCKSMDTKFC  120
YYNNYNVNQP RHFCKSCQRY WTAGGTMRNV PVGAGRRKNK NCRHVAADGF HNLSFNPTAT  180
ATATVLSFSH QTDNDHSSIA NQPAAMLPWP FPWNSAVFPP SPMPYYLWNS GGWALGKHPR  240
SGEVVDPQGQ KRRSSIVVPK TLRMDDPEEA ARSSIWSTLG IKYDAISREG LFKALQPKGG  300
DKKPAMAAAA ASPMLQANPA ALSRSLAFQE RA
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. A flanking TGT sequence contributes to the specificity of binding. Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The DNA-binding ability is not modulated by 'GIGANTEA' but the stability of CDF1 is controlled by the proteasome-dependent pathway. Ubiquitinated by the SCF(ADO3) E3 ubiquitin ligase complex. Binds to the FT promoter in the morning. {ECO:0000269|PubMed:16002617, ECO:0000269|PubMed:19619493, ECO:0000269|PubMed:22628657}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation at the protein level, but not at the mRNA level. Strongly decreased expression during the dark phase. Accumulates at high levels at the beginning of the day. {ECO:0000269|PubMed:16002617}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0218933e-52AC021893.18 Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0060A14, from chromosome 10, complete sequence.
GenBankAP0149663e-52AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126183e-52CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019199925.17e-93PREDICTED: cyclic dof factor 1-like
SwissprotQ8W1E33e-66CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A4D9C4R91e-145A0A4D9C4R9_SALSN; Dof zinc finger protein DOF5.5
STRINGXP_009771503.19e-90(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.13e-61cycling DOF factor 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Seaton DD, et al.
    Linked circadian outputs control elongation growth and flowering in response to photoperiod and temperature.
    Mol. Syst. Biol., 2015. 11(1): p. 776
    [PMID:25600997]
  4. Goralogia GS, et al.
    CYCLING DOF FACTOR 1 represses transcription through the TOPLESS co-repressor to control photoperiodic flowering in Arabidopsis.
    Plant J., 2017. 92(2): p. 244-262
    [PMID:28752516]
  5. Henriques R, et al.
    The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering.
    New Phytol., 2017. 216(3): p. 854-867
    [PMID:28758689]