PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00002559-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 319aa    MW: 36103.1 Da    PI: 8.6581
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00002559-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.66e-5491351129
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+++yL++kv ++++++  +i evd++kvePw+Lp ++k +ekewyfF+ rdkky+tg r+nrat++gyWkatgk
  SMil_00002559-RA_Salv   9 LPPGFRFHPTDEELITHYLCRKVIDSSFSA-IAIGEVDMNKVEPWELPWRAKLGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGK 95 
                            79*************************999.88***************888999********************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                            dke+++ ++ lvg+kktLvfy+grapkgek++Wv heyrle
  SMil_00002559-RA_Salv  96 DKEIFR-GKILVGMKKTLVFYRGRAPKGEKSNWVCHEYRLE 135
                            ******.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-606156IPR003441NAC domain
PROSITE profilePS5100556.7049156IPR003441NAC domain
PfamPF023651.2E-2710134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MKRDELMELP PGFRFHPTDE ELITHYLCRK VIDSSFSAIA IGEVDMNKVE PWELPWRAKL  60
GEKEWYFFCV RDKKYPTGLR TNRATAAGYW KATGKDKEIF RGKILVGMKK TLVFYRGRAP  120
KGEKSNWVCH EYRLEGKFSQ DKAAKNDWVI SRVFQKTSGG KKVHISGLVR MGSAAAALPP  180
LMDPSPYHNG EPESGHVHCF SNTDPIKIQE NFMNASFPIP PSSSDSFSPA FPWGNGVGFQ  240
YPASVPLQDP AILRQFLASY GHNMSYGFKN KKEIVSMSQE TVLSTDNSSV VSNLETGKRP  300
FQEQENAVEP QDLDCIWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-55716215171NO APICAL MERISTEM PROTEIN
1ut4_B9e-55716215171NO APICAL MERISTEM PROTEIN
1ut7_A9e-55716215171NO APICAL MERISTEM PROTEIN
1ut7_B9e-55716215171NO APICAL MERISTEM PROTEIN
3swm_A1e-54716218174NAC domain-containing protein 19
3swm_B1e-54716218174NAC domain-containing protein 19
3swm_C1e-54716218174NAC domain-containing protein 19
3swm_D1e-54716218174NAC domain-containing protein 19
3swp_A1e-54716218174NAC domain-containing protein 19
3swp_B1e-54716218174NAC domain-containing protein 19
3swp_C1e-54716218174NAC domain-containing protein 19
3swp_D1e-54716218174NAC domain-containing protein 19
4dul_A9e-55716215171NAC domain-containing protein 19
4dul_B9e-55716215171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071688.11e-161NAC domain-containing protein 79
RefseqXP_011071689.11e-161NAC domain-containing protein 79
RefseqXP_020547905.11e-161NAC domain-containing protein 79
SwissprotQ9FLJ21e-116NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A2Z7BJ031e-139A0A2Z7BJ03_9LAMI; Uncharacterized protein
STRINGEOY219051e-137(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-115NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]