PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00001196-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 292aa    MW: 32952.6 Da    PI: 5.0486
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00001196-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.73.8e-5661331128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtdeelv +yL +k++g ++el evi+evd+yk+ePwdLp k  + +++ ewyf+ +rd+ky++g+r+nrat+sgyWkat
  SMil_00001196-RA_Salv   6 LPPGFRFHPTDEELVAYYLDRKINGGTIEL-EVIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYGPRDRKYPNGSRTNRATRSGYWKAT 92 
                            79****************************.99**************96435566888****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v+s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  SMil_00001196-RA_Salv  93 GKDRTVHS-QKRAVGMKKTLVYYRGRAPHGVRTDWVMHEYRL 133
                            ********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-633154IPR003441NAC domain
PROSITE profilePS5100560.0716154IPR003441NAC domain
PfamPF023657.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGPMTLPPGF RFHPTDEELV AYYLDRKING GTIELEVIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYGPR DRKYPNGSRT NRATRSGYWK ATGKDRTVHS QKRAVGMKKT LVYYRGRAPH  120
GVRTDWVMHE YRLIDSVSTS TLKDSYALCR VLKKNIVITK TSKQESGVIW DDDSTPETSA  180
KQTEGSSSDV TQTTPGVAVV SSTPQIASDE VNSSIVDQFY YDATQNISDF NIQDYTGIFY  240
ESWYPALGVD DFPQIDHLSG DHVASDRCLN GIATLDEIYA VCSTHDNYAG SN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-57415515166NO APICAL MERISTEM PROTEIN
1ut4_B4e-57415515166NO APICAL MERISTEM PROTEIN
1ut7_A4e-57415515166NO APICAL MERISTEM PROTEIN
1ut7_B4e-57415515166NO APICAL MERISTEM PROTEIN
3swm_A5e-57415518169NAC domain-containing protein 19
3swm_B5e-57415518169NAC domain-containing protein 19
3swm_C5e-57415518169NAC domain-containing protein 19
3swm_D5e-57415518169NAC domain-containing protein 19
3swp_A5e-57415518169NAC domain-containing protein 19
3swp_B5e-57415518169NAC domain-containing protein 19
3swp_C5e-57415518169NAC domain-containing protein 19
3swp_D5e-57415518169NAC domain-containing protein 19
4dul_A4e-57415515166NAC domain-containing protein 19
4dul_B4e-57415515166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095829.11e-152NAC transcription factor 29
SwissprotQ9FFI56e-85NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A022QM931e-133A0A022QM93_ERYGU; Uncharacterized protein
STRINGMigut.M01499.1.p1e-134(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.15e-97NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]