PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00000968-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family HD-ZIP
Protein Properties Length: 302aa    MW: 34283.7 Da    PI: 4.6105
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00000968-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.3e-1981134356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++t++q++ Le+ Fe ++++  e++ +LA++lgL+ rq+ vWFqNrRa++k
  SMil_00000968-RA_Salv  81 KKRRLTADQVQFLERSFEADNKLEPERKVQLANELGLKPRQIAVWFQNRRARWK 134
                            56789************************************************9 PP

2HD-ZIP_I/II127.45.9e-4180170191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+++qv++LE+sFe+++kLeperKv+la+eLgl+prq+avWFqnrRAR+ktkqlE+dye+ +++y++lk++ ++L ke+++L+
  SMil_00000968-RA_Salv  80 EKKRRLTADQVQFLERSFEADNKLEPERKVQLANELGLKPRQIAVWFQNRRARWKTKQLETDYETFHARYETLKSDYDNLVKENDKLK 167
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eel 91 
                            +e+
  SMil_00000968-RA_Salv 168 AEV 170
                            987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.08E-1966138IPR009057Homeodomain-like
PROSITE profilePS5007117.91276136IPR001356Homeobox domain
SMARTSM003894.9E-1979140IPR001356Homeobox domain
CDDcd000864.05E-1881137No hitNo description
PfamPF000469.8E-1781134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-2082143IPR009057Homeodomain-like
PRINTSPR000311.4E-5107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000311.4E-5116132IPR000047Helix-turn-helix motif
PfamPF021834.0E-14136175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
LDMAGSAAVY GGGDAPNQAK KRNFDQPLDS IAAESSLGSN TMLNFGAVGG VKRSRNMLFS  60
SLDQEEFGEE YLDEYFNQQE KKRRLTADQV QFLERSFEAD NKLEPERKVQ LANELGLKPR  120
QIAVWFQNRR ARWKTKQLET DYETFHARYE TLKSDYDNLV KENDKLKAEV LRLKQNDVGG  180
DTEKVNLHLL DNKGLPKAMP REANARVISE DEESNGSVFA FKNEEQSSAK SEASNVGSPR  240
LTDGIHSPLL ESGITSHAFD RDYSDSSQIG EDNLHEEPDY VFPLSSFYYD GFPVEDHAFN  300
FW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087214.11e-103PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A022Q9Z13e-98A0A022Q9Z1_ERYGU; Uncharacterized protein
STRINGVIT_17s0000g05630.t018e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.18e-41homeobox 1