PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00000860-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 338aa    MW: 37394.1 Da    PI: 8.6958
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00000860-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.3e-54151421128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeelvv+yLkkkv++ +l++  +i+evd+yk++Pw+Lp k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+
  SMil_00000860-RA_Salv  15 LPPGFRFHPTDEELVVHYLKKKVASAPLPV-AIIAEVDLYKFDPWELPGKAIFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGT 101
                            79****************************.88***************7766789********************************* PP

                    NAM  89 dkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dk+v++  ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  SMil_00000860-RA_Salv 102 DKPVMTGgGTQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                            ******867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-657177IPR003441NAC domain
PROSITE profilePS5100562.10515176IPR003441NAC domain
PfamPF023651.1E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MESTDSSTGS QQPQLPPGFR FHPTDEELVV HYLKKKVASA PLPVAIIAEV DLYKFDPWEL  60
PGKAIFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVMTGGG TQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLVDNKPSSK PPGCDFVNKK GSLRLDDWVL CRIYKKNNAQ  180
RPLDQERDDI HDQLMGSINP QTLSMPSVGH HKYLESDHSL YDGMMSDAMN PHLASSKAAL  240
HLLPPHTLKR TINPSLYWND DSSPGPGPGT SPSTKRFLGD TCDGGTRGGA SDDATNSIAT  300
ILSQLPQTPT LQQQQAMLGN LGDGVFGQQP YHQVNWYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-7511799171NAC domain-containing protein 19
3swm_B2e-7511799171NAC domain-containing protein 19
3swm_C2e-7511799171NAC domain-containing protein 19
3swm_D2e-7511799171NAC domain-containing protein 19
3swp_A2e-7511799171NAC domain-containing protein 19
3swp_B2e-7511799171NAC domain-containing protein 19
3swp_C2e-7511799171NAC domain-containing protein 19
3swp_D2e-7511799171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098344.11e-169NAC transcription factor 56
SwissprotQ9LD441e-113NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A2G9HYQ01e-166A0A2G9HYQ0_9LAMI; Uncharacterized protein
STRINGMigut.M00864.1.p1e-163(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-104NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]