PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00000011-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 224aa    MW: 24689.6 Da    PI: 6.0118
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00000011-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.3e-384299562
                 zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           a +cprC s+ntkfCyynnys+sqPryfCkaCrryWtkGG+lrnvPvGgg+rk ++ss
  SMil_00000011-RA_Salv 42 APSCPRCLSSNTKFCYYNNYSVSQPRYFCKACRRYWTKGGSLRNVPVGGGCRKTRRSS 99
                           668***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-234094IPR003851Zinc finger, Dof-type
PfamPF027014.7E-324397IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5184397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSSSSNNHPF LDHQFPKIKP SLLMMGSCKT LKWKPYSAIE AAPSCPRCLS SNTKFCYYNN  60
YSVSQPRYFC KACRRYWTKG GSLRNVPVGG GCRKTRRSSR ALSRRPPPSE SLANAAAPPK  120
HDDYEGSNFA AAEMFECGGD VGVINGGQVH GSFDGGDFVC ENFGVFEVEG IGIESEMFPN  180
LEGFGCGQPP LMEMQEFEVF SSGDDHSLMT DNWGSFDLSA YENF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763881e-50AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843601e-50AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-33Dof family protein