PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_25982.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family CO-like
Protein Properties Length: 386aa    MW: 42475.7 Da    PI: 6.5547
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_25982.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box223.3e-072662440
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkgHtvv 40
                             + C+ ++   +  fC+++++++C +C ++ H +H++v
  Sme2.5_25982.1_g00001.1 26 KSCEYCHVAAALVFCRTDNMFVCLSCDTSLHARHERV 62
                             57*****999************************976 PP

2zf-B_box254e-0862107342
                 zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                               ++C+ +e+  ++  C+ +   lC  C   +H+       H++vp+
  Sme2.5_25982.1_g00001.1  62 VWVCEVCEQAAASVTCRADAAALCVVCDRDIHSAnplaerHERVPV 107
                              689*******9*********************66999999999986 PP

3CCT69.39.8e-24309352144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Sme2.5_25982.1_g00001.1 309 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 352
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.6E-72364IPR000315B-box-type zinc finger
PROSITE profilePS501199.6552364IPR000315B-box-type zinc finger
PfamPF006432.3E-52662IPR000315B-box-type zinc finger
CDDcd000211.10E-82864No hitNo description
Gene3DG3DSA:4.10.45.103.4E-43660IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8560107IPR000315B-box-type zinc finger
PfamPF006432.9E-661107IPR000315B-box-type zinc finger
CDDcd000211.10E-863107No hitNo description
SMARTSM003369.4E-965107IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638309351IPR010402CCT domain
PfamPF062038.7E-18309351IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGIFREAPNC FPQGWCGSGA AARMVKSCEY CHVAAALVFC RTDNMFVCLS CDTSLHARHE  60
RVWVCEVCEQ AAASVTCRAD AAALCVVCDR DIHSANPLAE RHERVPVIPF YHPVESVVKS  120
TASTLLVSIN GLDDAFTATR TTTTTTGITP ACVGHHDQED YNTDPWIPPN TITSKLPLNT  180
EMKSLGFMFS DSENFLDFDY PVSVEAQAQA QYNSANDSVV PVQTTAIKPL PFHHHEKHFE  240
IDFTQSHIKS YNTPSLSVSS SSLDVGIVPD GSSISEISHP FMKSMNNSSS IDLSSSANHQ  300
GEKLLGLDRE ARVLRYREKK KNRKFEKTIR YASRKAYAET RPRIKGRFAK RTEAGAGAGE  360
FDDIDGIFSG ADLVTSDSRY GVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234448.10.0CONSTANS-like protein
TrEMBLA0A3Q7I0610.0A0A3Q7I061_SOLLC; Uncharacterized protein
STRINGSolyc07g006630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-94CONSTANS-like 5