PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_18408.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 186aa    MW: 22132.4 Da    PI: 9.6721
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_18408.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM115.45.7e-363615312128
                      NAM  12 eelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                              +el+++yL++k+ + +le  + i e++iyk++P+ + +  k ++ ek wy  ++rd+ky++ +r++++t +gyWkatg d+++++ 
  Sme2.5_18408.1_g00001.1  36 SELITHYLERKIGNLRLEP-NKIYEMNIYKYDPKMIVAyvKPTTAEKVWYILTPRDRKYQNRHRPSKSTGNGYWKATGADRDIKDD 120
                              79**************999.77**************74235556888**************************************9 PP

                      NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              k+  vg++k Lv+y g+apkg+kt+W+mheyrl
  Sme2.5_18408.1_g00001.1 121 KNVIVGVRKALVYYYGKAPKGQKTNWIMHEYRL 153
                              999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.20325180IPR003441NAC domain
SuperFamilySSF1019411.44E-4136179IPR003441NAC domain
PfamPF023655.1E-1836153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
NLNLFDEKQN NMEFLDEDVD DVPIKGTRIL SDIYQSELIT HYLERKIGNL RLEPNKIYEM  60
NIYKYDPKMI VAYVKPTTAE KVWYILTPRD RKYQNRHRPS KSTGNGYWKA TGADRDIKDD  120
KNVIVGVRKA LVYYYGKAPK GQKTNWIMHE YRLTGVPDIS QRGPKDLKLD DWVLCRIRFM  180
HEYRLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-393717729162NO APICAL MERISTEM PROTEIN
1ut4_B6e-393717729162NO APICAL MERISTEM PROTEIN
1ut7_A6e-393717729162NO APICAL MERISTEM PROTEIN
1ut7_B6e-393717729162NO APICAL MERISTEM PROTEIN
3swm_A7e-393717732165NAC domain-containing protein 19
3swm_B7e-393717732165NAC domain-containing protein 19
3swm_C7e-393717732165NAC domain-containing protein 19
3swm_D7e-393717732165NAC domain-containing protein 19
3swp_A7e-393717732165NAC domain-containing protein 19
3swp_B7e-393717732165NAC domain-containing protein 19
3swp_C7e-393717732165NAC domain-containing protein 19
3swp_D7e-393717732165NAC domain-containing protein 19
4dul_A6e-393717729162NAC domain-containing protein 19
4dul_B6e-393717729162NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793862.11e-64PREDICTED: NAC domain-containing protein 102-like
RefseqXP_016578729.11e-64PREDICTED: NAC domain-containing protein 72-like
SwissprotQ390136e-43NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A314KWZ24e-64A0A314KWZ2_NICAT; Nac transcription factor 25
STRINGXP_009793862.14e-64(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139361213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-45NAC family protein
Publications ? help Back to Top
  1. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  2. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  3. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  4. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  7. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  8. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  9. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]