PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_15948.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 714aa    MW: 79758.2 Da    PI: 8.4049
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_15948.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.21.5e-31533588359
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              ++rY eClkNhAas+GghavDGC+Efmps geegt+ alkCaAC CH nFHR+e ++
  Sme2.5_15948.1_g00001.1 533 SIRYGECLKNHAASMGGHAVDGCREFMPS-GEEGTPGALKCAACSCHQNFHRKEIDD 588
                              789*************************9.999********************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF141111.0E-7286363IPR025558Domain of unknown function DUF4283
PfamPF047701.4E-29534586IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-19534587IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.1E-27535586IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.399536585IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MQTPPTPATK NSQRRCDADD DEQTTTTRMT TTKDTDADDD EEHRRRRRRR RRQRRRAQTQ  60
ATTTTTTTTK DTNADDDEEH RRRRRRRGRR RRSTQTQATT QTTQTTTTET MTTQTTRKRV  120
VTLVGGRDER LGRWVVEEGD KVGHVVLVGG VVGWGECTGW LGVEALWLVG VRVRVGEMNP  180
STLLGSALEW VGGGVCVELR FGFRQEDGVV GERGERWGRW VVEEGDEVGY AVRVGVRVGD  240
FIVELDCKGF FMQKGGNHWE RPPMEVRHSN YMGYPTDTFP RKSGESLVSD YKLTLIGNFS  300
YRRPKMKQIR ADFRAQNPLN GQVKIRHCTY RQVLLLFTNE EDYYTVLYKK TFILAGALMQ  360
ISCPSPDFHH EAKQNIDPDF RLSDANPVNC STDTSRLHPC INGLPAPATD EKPMSLQLPA  420
VSQCLSVPLL HPPLPLLANS VSVASRLCAD RLTASGIYVP LSYPKGIVGS PSFGRNEQAV  480
RGNTFPSPGQ AVNRLNLAQQ RNQLNLYKEP NMTSRIAQSQ PPSTTSVSGT TSSIRYGECL  540
KNHAASMGGH AVDGCREFMP SGEEGTPGAL KCAACSCHQN FHRKEIDDHQ QMADVGSHST  600
FSQLRNNSSC GSIQKLAPLS LPTQQLQQYH HNFSNSCSLS SLIGKQQEYS WRDNNRAPDN  660
IPLDFPACSS RCQSQSVFTD EFPHLDIIDN LLGEEHGTVQ TSMSNSGFQS LSNG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14351RRRRRRRRR
24451RRRRRRRR
35055RRQRRR
48086RRRRRRR
58090RRRRRRRGRRR
68188RRRRRRGR
78189RRRRRRGRR
88289RRRRRGRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326743.10.0PREDICTED: uncharacterized protein LOC101258410 isoform X3
RefseqXP_015086489.10.0PREDICTED: uncharacterized protein LOC107029567 isoform X1
RefseqXP_015086490.10.0PREDICTED: uncharacterized protein LOC107029567 isoform X2
TrEMBLK4CVY20.0K4CVY2_SOLLC; Uncharacterized protein
STRINGSolyc09g089550.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14101810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.13e-24mini zinc finger 1