PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_14136.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 103aa    MW: 11488.8 Da    PI: 4.8553
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_14136.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer67.42.6e-211670358
              ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                              ++Y  ClkNhA + G ++vDGC Ef++s g++gt++ + Ca C+C R FHR +++
  Sme2.5_14136.1_g00001.1 16 VIKYGVCLKNHATKFGDYVVDGCLEFVKS-GDNGTKEEFICATCECFRGFHRMNNQ 70
                             579*************************9.9999******************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.0E-231769IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-101866IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-161867IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152318.3331968IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MANNSISSNP SDDGKVIKYG VCLKNHATKF GDYVVDGCLE FVKSGDNGTK EEFICATCEC  60
FRGFHRMNNQ SFYRDPVIRP PLTLSDCERS SVDESLPSEE NKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755136e-48HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321229.18e-29PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9SB611e-14ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLM1DCM91e-36M1DCM9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000868603e-36(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13748615
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.17e-16homeobox protein 22