PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_12391.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 527aa    MW: 60870.6 Da    PI: 6.5193
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_12391.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like56.37.1e-18295344454
                  G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                              ++Wt++LH++F+++v+qL G+ +  P +i elm+ + Lt+ +v+SHLQk R
  Sme2.5_12391.1_g00003.1 295 IEWTEDLHAKFMDVVHQL-GEGQCYPNNIHELMNSPRLTRMQVASHLQKCR 344
                              79****************.99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077274.5E-681186IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566725.56E-1315163No hitNo description
Gene3DG3DSA:1.10.10.605.4E-18290345IPR009057Homeodomain-like
SuperFamilySSF466892.87E-13290345IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-16292345IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
DYNEIFSPVV RYTSIRVLLA MVVHQDLELE QLDVKTAFLH GVLEEDIYMT QPDGFQVPET  60
EDYVCKLKKS LYGLKQCPRQ WYKRFDGFII EIGYNRSPYD CCVYHNKLKN ISYIYLVLYV  120
DDILIATENK SDIQRLRGLL SAEFEMKDLG AAKKILGMEI YSDRNQKKLF VSQKGYTQKI  180
LSRFVVCDEF NELVAKKTLE NGGYLYLKQS FEKKIMKYLC QFVLREKMRS EKEREGLGNN  240
NIVGEDEESR EEESNNIHEV ENDIVLNGRY KPRKKRSRKS MKEINEGKSR RKNYIEWTED  300
LHAKFMDVVH QLGEGQCYPN NIHELMNSPR LTRMQVASHL QKCRRNNWRS PKQRKNIRQR  360
SSQHDIDNPF NSSFLSPQPN VGAGLQQDGS LFDFNVVQGA TYPSSRIVSG THNDYNLNVN  420
VDNMAIYSSS AMMSDTYAGN FTINGLGATN ANTNFQQYVG EPNMSYPRTV VAASCENYVE  480
GNTSNEMVTY NVDYLFQNLG PPGANLPNEQ ENVFDQGYSD DLVSTFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6445981e-162DQ644598.1 Solanum melongena clone pS.m.G Ty1-copia retrotransposon nonfunctional polyprotein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025886090.12e-80putative two-component response regulator ARR13
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.19e-11GBF's pro-rich region-interacting factor 1