PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_12113.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 123aa    MW: 14247.4 Da    PI: 10.9094
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_12113.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like751e-2361114255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt eLH+rFv +v+ LGG+  AtP +i+++m+  g+++++++ HLQ YR 
  Sme2.5_12113.1_g00001.1  61 PRMRWTDELHARFVAVVNGLGGPRAATPMAIMKHMEHMGISRQQIRAHLQAYRQ 114
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1959115IPR009057Homeodomain-like
SuperFamilySSF466891.2E-1259116IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-1861115IPR006447Myb domain, plants
PfamPF002492.1E-662113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MFPRSHFPVV KNDNFELVFN VDDTKRYDPY IFNFNLVTHQ YRQRVDQRPS VVASASHGKP  60
PRMRWTDELH ARFVAVVNGL GGPRAATPMA IMKHMEHMGI SRQQIRAHLQ AYRQKLAAGY  120
PSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14605411
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.13e-14G2-like family protein