PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_10927.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 282aa    MW: 31590.6 Da    PI: 7.7026
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_10927.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.8e-332680155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Sme2.5_10927.1_g00004.1 26 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 80
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-322381IPR009057Homeodomain-like
PROSITE profilePS5129412.4552383IPR017930Myb domain
TIGRFAMsTIGR015571.9E-242681IPR006447Myb domain, plants
SuperFamilySSF466892.87E-162683IPR009057Homeodomain-like
PfamPF002498.4E-92879IPR001005SANT/Myb domain
PfamPF143791.7E-22127172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDRMYSGGGE MGYGYENGVV MTRDPKPRLR WTADLHDRFV DAVTKLGGPD KATPKSVLRL  60
MGLKGLTLYH LKSHLQKYRL GQQTKKQNAA EQNREKIGES FREFSLHTSG PSITSSSMNG  120
MQGEAPTSEA LRCQIEVQKK LQEQLEVQQK LQMRIEAQGK YLQAVLDKAQ KSLSTDMNSP  180
SAVEETRAQL TDFNMALSNL VDYMHGPNGD ETLAGRRTQD DTSKDLQTST YLTEGEQKKI  240
MNIKLEETSV SFDLTSRSSY DFIGMNSVAL EAKSFSNGRL EI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3031701e-167AY303170.1 Solanum bulbocastanum chromosome 8 clone UW3A14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245962.10.0myb family transcription factor PHL11 isoform X2
SwissprotC0SVS44e-83PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A3Q7HTE61e-180A0A3Q7HTE6_SOLLC; Uncharacterized protein
STRINGSolyc08g076010.2.11e-180(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-71G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]