PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_10540.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bZIP
Protein Properties Length: 189aa    MW: 22206.6 Da    PI: 6.3072
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_10540.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.34e-1483141563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN+ L+ +l++ ++  +k   e+
  Sme2.5_10540.1_g00002.1  83 RKQRRMISNRESARRSRMRKQRHLDELWSHVLRLRTENHNLIIKLNQVSESHEKIVREN 141
                              79**********************************************99998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.880.105.0E-54896IPR008917Transcription factor, Skn-1-like, DNA-binding domain
SMARTSM003381.3E-1379143IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.74981144IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-1183133No hitNo description
PfamPF001703.0E-1283141IPR004827Basic-leucine zipper domain
CDDcd147021.08E-1784134No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-1097155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MLSSEASTIH YLAPHAQNPS SPLPFDYTFM HKNLSTFQFN TFLTNNSNNN DNIPNYPIQD  60
FMSTNSTTSD ESEEQQHRII DERKQRRMIS NRESARRSRM RKQRHLDELW SHVLRLRTEN  120
HNLIIKLNQV SESHEKIVRE NMQLKDEASD LRRLLTDIQL IDSPNLDDFS ELYDIPCSLK  180
AESSNQSNT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195102RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754438e-98HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574619.17e-86PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC22e-36BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A1U8H2I22e-84A0A1U8H2I2_CAPAN; Basic leucine zipper 43
TrEMBLA0A2G2ZI612e-84A0A2G2ZI61_CAPAN; basic leucine zipper 43-like
STRINGSolyc04g005170.1.12e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-38basic leucine-zipper 58
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]