PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_09643.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 272aa    MW: 31404.4 Da    PI: 6.0968
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_09643.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.46e-49101381129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkat
  Sme2.5_09643.1_g00001.1  10 LPPGFRFYPSDEELVCHYLFKKIANEDVLK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATISGYWKAT 94 
                              79************************9655.78***************87788899****************************** PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkd++v++  ++  vg++ktLvfy +rap+g kt W+mhe+rle
  Sme2.5_09643.1_g00001.1  95 GKDRTVVDPkTRMIVGMRKTLVFYLNRAPNGIKTGWIMHEFRLE 138
                              ********855667***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-608156IPR003441NAC domain
PROSITE profilePS5100556.95610156IPR003441NAC domain
PfamPF023657.7E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KIANEDVLKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV VDPKTRMIVG MRKTLVFYLN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFHKGKGE NNSNSNNNIL NPRSMYEIGV  180
NTCPNMDQSH ALPYAAGTFS QRPVNHHQSQ NQSSYLQLMS QEMKEPLSSN DQMAEDDDYG  240
FLLDMNFEDP NLQNDSSIGN MRFDDENSLV FI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-49915619168NAC domain-containing protein 19
3swm_B6e-49915619168NAC domain-containing protein 19
3swm_C6e-49915619168NAC domain-containing protein 19
3swm_D6e-49915619168NAC domain-containing protein 19
3swp_A6e-49915619168NAC domain-containing protein 19
3swp_B6e-49915619168NAC domain-containing protein 19
3swp_C6e-49915619168NAC domain-containing protein 19
3swp_D6e-49915619168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-112HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565477.11e-165PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE65e-62NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2G2X5W61e-164A0A2G2X5W6_CAPBA; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A2G3CVA51e-164A0A2G3CVA5_CAPCH; Protein CUP-SHAPED COTYLEDON 3
STRINGPGSC0003DMT4000266441e-157(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-96NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]