PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_09080.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 258aa    MW: 29384.2 Da    PI: 4.325
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_09080.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.9e-381372362
                   zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             e+a +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk+++s+
  Sme2.5_09080.1_g00001.1 13 EQAPNCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRSR 72
                             67789***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-27265IPR003851Zinc finger, Dof-type
PfamPF027013.2E-321470IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6211670IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101854IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MIMMERTRKS NIEQAPNCPR CASTNTKFCY YNNYSLSQPR YFCKGCRRYW TKGGSLRNVP  60
VGGGCRKSRR SRSTRKDDNT LQTPSPALDA PGAHDIDLAD VFAKYLNQGT TNKDHDDNIV  120
LQESQDYSSI GASLSDSPSS DSFINNPNSF ENESLLDEAI MGNFQDYPCG YFLQEEQGGP  180
INQDFLDFNT SFLEMQAMVG QVEEFDYYNT SNNFEWQPMM QYQDFGSILE LDDQLKNSPT  240
NLASDNHNYS PFDLSNYI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158674.11e-148PREDICTED: dof zinc finger protein DOF2.1-like
SwissprotQ9SVC52e-41DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLM0ZJJ71e-148M0ZJJ7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000020601e-148(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.13e-36Dof family protein