PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_08713.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 333aa    MW: 37214.7 Da    PI: 6.8819
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_08713.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.31.8e-50111311121
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhP+deel+++yL +k++++++ ++++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat+sgyWk+t
  Sme2.5_08713.1_g00002.1  11 LPPGFRFHPSDEELITYYLMNKISDSNNFTARAIGDVDLNKSEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNSGYWKTT 96 
                              79***********************99777799***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdW 121
                              gkdke++++++elvg+kktLvfy+grap+gekt+W
  Sme2.5_08713.1_g00002.1  97 GKDKEIFNNSSELVGMKKTLVFYRGRAPRGEKTNW 131
                              *********************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-556143IPR003441NAC domain
PROSITE profilePS5100548.06211163IPR003441NAC domain
PfamPF023657.1E-2312131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEGEVKEEID LPPGFRFHPS DEELITYYLM NKISDSNNFT ARAIGDVDLN KSEPWDLPGK  60
AKMGEKEWYF FSLRDRKYPT GVRTNRATNS GYWKTTGKDK EIFNNSSELV GMKKTLVFYR  120
GRAPRGEKTN WQDEWVVCRV FQKSIVGVKK YPPNNNTSRI HVNPYTTLDP NTICMSSQMM  180
MPQLADQHNA FQLAMGRSSS TPPTYMINNN PEIQELNRVF RGISSSNMMP ILQSQINYNL  240
GDGGGGNNCF TISGLNLNLG GGGGGGGATT SQPMRPPPPP PPTQDMGSSS HVMMTTHDQA  300
GYGHEDMSGG NAMNRFMAME NGTHDLDNYW TTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46814314165NO APICAL MERISTEM PROTEIN
1ut4_B2e-46814314165NO APICAL MERISTEM PROTEIN
1ut7_A2e-46814314165NO APICAL MERISTEM PROTEIN
1ut7_B2e-46814314165NO APICAL MERISTEM PROTEIN
4dul_A2e-46814314165NAC domain-containing protein 19
4dul_B2e-46814314165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754477e-75HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755177e-75HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355216.11e-166PREDICTED: NAC domain-containing protein 83-like
TrEMBLM1CW691e-165M1CW69_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000761031e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.27e-82NAC domain containing protein 38