PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_08558.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 295aa    MW: 33405.4 Da    PI: 9.4576
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_08558.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-3258111255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               rlrWtp+LH+rFv+ave+LGG+++AtPk il+lm++kgL ++hvkSHLQ+YR+
  Sme2.5_08558.1_g00002.1  58 VRLRWTPDLHRRFVQAVERLGGPDRATPKLILQLMNIKGLNIAHVKSHLQMYRS 111
                              59***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.12454114IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-3054112IPR009057Homeodomain-like
SuperFamilySSF466891.36E-1559112IPR009057Homeodomain-like
PfamPF002493.9E-959110IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.2E-2459113IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MMEDDGDTQF SPNSGKNEEE DENTSTKLPK DGGSSSNSTI EEGVKNYTVR PYVRSKMVRL  60
RWTPDLHRRF VQAVERLGGP DRATPKLILQ LMNIKGLNIA HVKSHLQMYR SKKIDDPAQG  120
STNHHKLFME SGDPYIFNLS QLPMLSSFNQ RFNSTFRYGD VSSRNFQDDK LMHSSIMGQS  180
TIDKARTTLY TTLNERIFGS NHIDKLTPLF QMAEKSQARR LSPLKRKAMH CDLNLSLGVK  240
QKNNSHGDDD EDDDDGSTLT LSLSSQRSPS RLKEDANYAT IKNARRGTST LDLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-1859113357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1859113357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1859113357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1859113357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-140HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249715.11e-163uncharacterized protein LOC101244920
TrEMBLA0A3Q7IJK01e-161A0A3Q7IJK0_SOLLC; Uncharacterized protein
STRINGSolyc10g076460.1.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-55G2-like family protein