PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_08231.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 507aa    MW: 58223.1 Da    PI: 10.2291
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_08231.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like63.15.3e-20170219454
                  G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                              ++Wt++LH++F+eave L G+ +  P +ile+m+v+gLt+ +v+SHLQk R
  Sme2.5_08231.1_g00001.1 170 IEWTEDLHTKFMEAVELL-GEGRCYPMEILEVMNVPGLTRMQVASHLQKCR 219
                              79****************.9*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.235189IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.6E-511111No hitNo description
SuperFamilySSF466891.7E-15165220IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-19166220IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-18167220IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MTVDTISTAM LTLSKGKQKI DMMILNVHST NLLSFDLLRQ AVALDIISLV VCDELDEIVA  60
KKVLDDGAYL YLKKPLNKEI VNYLWQFVLS EKIRREKARE RSEKNNHLTK KNVSDTEEQS  120
NTIHEAENDV ILNGKYKLRR NKGIQSMKEI NEGESQNNAT SKVVRQKNYI EWTEDLHTKF  180
MEAVELLGEG RCYPMEILEV MNVPGLTRMQ VASHLQKCRR NNWRSPKERK SNRHRSCQQS  240
SSVSHAPRSG FRKFGTMPRL QANVSNQRKS NRYRSCQQSS SVSHAPRSGF RKFGTMPRLQ  300
GNVPNQTQRG QGFPFPTLNT TYSFARGESS IQQLYCPQLQ VQPHRLNIGN QILTTQTNVG  360
GGLQHGPLFD LNVSPSATYS GSRIVLGTDI ENTTSVDNVI TYSSSAMKAD TYVGNVTING  420
SGATNASESN TYFNFNNMGY LFQNMGHSMV TTIKVLRWWW RTPNIPPTHC RWWWRGPIQR  480
WSHLWGRWRW HSSELHLLHI FNDWLLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2357925e-49AC235792.1 Solanum lycopersicum chromosome 3 clone C03HBa0029M12, complete sequence.
GenBankBT0143225e-49BT014322.1 Lycopersicon esculentum clone 133578R, mRNA sequence.
GenBankHG9754425e-49HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755155e-49HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165596.11e-155PREDICTED: putative two-component response regulator ARR13
TrEMBLM1CN231e-130M1CN23_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000709841e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.16e-21response regulator 2