PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_07454.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 200aa    MW: 22868.3 Da    PI: 9.4556
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_07454.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like58.61.3e-1854107255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              +r+rWt+eL + F+  v++ GG+    P++il+ m+  g+t++++kSHLQ YR 
  Sme2.5_07454.1_g00006.1  54 TRMRWTKELQAMFIAIVDNFGGPWAVKPRHILREMEHMGITIHQIKSHLQAYRA 107
                              6****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.34E-1152109IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-1752109IPR009057Homeodomain-like
PfamPF002491.6E-555106IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.0E-1755108IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MNERKGGEQQ QQSSLQIIGL SGGLNIINNV NYGLNVNVNQ QSNDVVLASR GRSTRMRWTK  60
ELQAMFIAIV DNFGGPWAVK PRHILREMEH MGITIHQIKS HLQAYRAKLD PNGVRGRRRR  120
SKASLEKKLV QDVQEQSKNV DEWKADNDVH FTQPPIKEEM MGDDDVHFPL PLIKVEMMEA  180
NVPSMIDNVF IEKIYVIAIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A3Q7J4J11e-39A0A3Q7J4J1_SOLLC; Uncharacterized protein
STRINGSolyc12g011260.1.12e-40(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14605411
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G06020.12e-12G2-like family protein