PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_06485.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family CO-like
Protein Properties Length: 305aa    MW: 34160 Da    PI: 6.3114
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_06485.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.11.3e-061043336
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                             +++C+ ++  + + fC+ +  +lC  C +++H  
  Sme2.5_06485.1_g00004.1 10 AKRCDACKTTPSTVFCKADMAFLCLPCDSKIHAA 43
                             579*****************************54 PP

2zf-B_box25.52.8e-085395339
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                              ++C+ +e+ +++  C+ +   lC++C + +H+       H++
  Sme2.5_06485.1_g00004.1 53 VWVCEVCEHAPATVTCKADAAALCNTCDQDIHSAnplarrHER 95
                             689*****************************65777777876 PP

3CCT68.81.4e-23241285145
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Sme2.5_06485.1_g00004.1 241 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRKE 285
                              9*****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.627855IPR000315B-box-type zinc finger
SMARTSM003364.4E-10855IPR000315B-box-type zinc finger
CDDcd000214.31E-71255No hitNo description
PROSITE profilePS5011910.4955198IPR000315B-box-type zinc finger
PfamPF006432.1E-65397IPR000315B-box-type zinc finger
CDDcd000216.17E-85498No hitNo description
SMARTSM003364.4E-105698IPR000315B-box-type zinc finger
PfamPF062031.0E-17241283IPR010402CCT domain
PROSITE profilePS5101716.787241283IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MVAESWSTTA KRCDACKTTP STVFCKADMA FLCLPCDSKI HAANKLASRH ARVWVCEVCE  60
HAPATVTCKA DAAALCNTCD QDIHSANPLA RRHERFPVVP FYDSDSARSR TAADHSSENP  120
QETEEEEAEA ESWLLQAPSN NNVDYKSAEY LFSEADPYLE MDVIADQKPS DIVHYPYKED  180
CVVPHVLNKN NEIQLQGSVV DGYPTYEMDF SGGSKPFMYN FTTQSISQSS SSLGGISSSD  240
REARVLRYRE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF AKRKENDAVD SLVASDASYG  300
VVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754471e-118HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006357063.11e-167PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T93e-87COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLM1CHN21e-165M1CHN2_SOLTU; B-box zinc finger protein 5
STRINGPGSC0003DMT4000676571e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-84CONSTANS-like 4