PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_05716.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 341aa    MW: 38291 Da    PI: 7.042
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_05716.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1048.7e-332276155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+Wtp+LH+rFv+av+qLGG++kAtPk+++++m+++gLtl+h+kSHLQk+Rl
  Sme2.5_05716.1_g00005.1 22 KPRLKWTPDLHQRFVDAVSQLGGPDKATPKSLMRVMNIHGLTLYHLKSHLQKFRL 76
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.5491979IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-302079IPR009057Homeodomain-like
SuperFamilySSF466891.27E-152177IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-232277IPR006447Myb domain, plants
PfamPF002494.2E-72474IPR001005SANT/Myb domain
PfamPF143791.1E-21142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MALDQNAQQS KDMNLVLSSD AKPRLKWTPD LHQRFVDAVS QLGGPDKATP KSLMRVMNIH  60
GLTLYHLKSH LQKFRLGKSQ VTDQSFDESK QEDKLDLSAT VHDDDRGLKQ RTYFDTELSQ  120
SDHKLSLGVC DGSQNQMNES SQIARALQMQ MEVQRKLHQQ IEVQRHLQLR IEAQGKYLQS  180
VLRKAQETLA SYGTSSGVEL AKAELSQLAS MVNMGCCPSS SLSAITDIDG SISKDTHTKT  240
LKGGILCSIE SSLTSSESSA RKEDWNDMQN IKNSTSICLS LNQETKGKKR SRSNICDEQS  300
SGKRFFETID LNRKCPNEYD EIGPKVIDLN SKEVEQFHEY S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-192278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-192278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-192278157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-192278157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-192178158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-122HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571687.10.0PREDICTED: uncharacterized protein LOC107869749 isoform X1
SwissprotF4I2743e-74PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A1U8GK930.0A0A1U8GK93_CAPAN; uncharacterized protein LOC107869749 isoform X1
STRINGPGSC0003DMT4000474130.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60361932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-73G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]