PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04714.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family CO-like
Protein Properties Length: 378aa    MW: 41723.4 Da    PI: 6.1451
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04714.1_g00007.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.49.1e-061143436
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                             + C+ ++   ++ fC+ ++ +lC +C  ++H+ 
  Sme2.5_04714.1_g00007.1 11 KLCDSCKTTSATVFCRADSAFLCLECDCKIHEA 43
                             68******99*******************9965 PP

2zf-B_box27.94.9e-095398342
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                              ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  Sme2.5_04714.1_g00007.1 53 VWVCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHERVPV 98
                             689*****************************66899999999986 PP

3CCT70.44.4e-24315358144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Sme2.5_04714.1_g00007.1 315 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 358
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.111855IPR000315B-box-type zinc finger
SMARTSM003361.4E-9855IPR000315B-box-type zinc finger
CDDcd000214.71E-71255No hitNo description
PROSITE profilePS5011910.8935198IPR000315B-box-type zinc finger
PfamPF006433.7E-75398IPR000315B-box-type zinc finger
CDDcd000213.05E-95498No hitNo description
SMARTSM003361.0E-105698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.896315357IPR010402CCT domain
PfamPF062032.6E-18315357IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGSENWSLTA KLCDSCKTTS ATVFCRADSA FLCLECDCKI HEANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD RDIHSANPLA RRHERVPVVP FYDSAVAKSH GGGGGGGGDD  120
EKYFDGTNED PPQPEEEAEA ASWILPTPKE GNDQYKSADY LFNDMDSYLD IDLMSCEQKS  180
HTVHHQQQHQ HGHYSSDGVV PVQSNNEAST HLPGPIVDGF PTYEMDFTGS KPYMYNFNSQ  240
SISQSVCIFS LQFSSTFSFR KSHFAFFFQV SSSSMDVGVV PDHSATTDVS NTFVMTSSTG  300
AGADVVPSPV SGLDREARVM RYREKRKNRK FEKTIRYASR KAYAETRPRI KGRFAKRTEI  360
EIDSLIAADA SYGVVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8826840.0DQ882684.1 Solanum tuberosum CONSTANS-like protein (CO) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253053.10.0zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T95e-96COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A3Q7JCU50.0A0A3Q7JCU5_SOLLC; Uncharacterized protein
STRINGSolyc12g096500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-96CONSTANS-like 4