PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04712.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 246aa    MW: 27493.9 Da    PI: 8.0885
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04712.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.51.4e-3253107358
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                              k +YkeClkNhA+ +GghavDGCgEf+p+ ge+g++++lkCaAC+CHRnFHR+ ++
  Sme2.5_04712.1_g00002.1  53 KPKYKECLKNHAVGIGGHAVDGCGEFLPA-GEDGSIDSLKCAACNCHRNFHRKVTQ 107
                              679*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015662.2E-3055104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.9E-2955106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2155108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.50656105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.8E-29170245IPR009057Homeodomain-like
SuperFamilySSF466893.84E-18172244IPR009057Homeodomain-like
TIGRFAMsTIGR015651.3E-23183239IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEFEDQEKQR DEEIPAPPSH HNSDSAQPTA KMPPSPRLDL EPLTAVQLWT NNKPKYKECL  60
KNHAVGIGGH AVDGCGEFLP AGEDGSIDSL KCAACNCHRN FHRKVTQTPL AAGGGGGEPV  120
PFVYQSHNQL PAYYRTLPPP CGYLQYHVAP HHRPLALPST SGAGGYREDQ EDISNPNYSG  180
GSKKRFRTKF SQVQKEKMQD LADKIGWRIQ REDETLVQQM CNETGITRQV FKVWMHNNKH  240
TLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-211832411775ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-142HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072308.11e-158PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotA2Z2591e-69ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLM1C6691e-157M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606231e-156(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-67homeobox protein 22