PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04506.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 143aa    MW: 16302.6 Da    PI: 7.9241
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04506.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.31.7e-2846100155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr rWt eLHe Fv+av++LGG+ +AtPk+i++lm+ +++t +h+kSHLQkYR 
  Sme2.5_04506.1_g00005.1  46 KPRFRWTVELHELFVKAVNELGGPYEATPKNIVKLMDDEDITPDHIKSHLQKYRQ 100
                              79****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.22843103IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2644101IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1645101IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2246101IPR006447Myb domain, plants
PfamPF002492.3E-85099IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MFFRHILSCR IPGITTEDCE NMPEHSKKQK GETSEKVGAS HDLNKKPRFR WTVELHELFV  60
KAVNELGGPY EATPKNIVKL MDDEDITPDH IKSHLQKYRQ SKDIINNNRS ISKAHKSLIQ  120
CGETCRISKE VSSEINVCGE VLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1846102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1846102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1846102157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1846102157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1846102258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}.
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579061.11e-55PREDICTED: probable transcription factor KAN3
SwissprotB8B5N81e-17PHR2_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 2
SwissprotQ6Z1561e-17PHR2_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 2
TrEMBLA0A1U8H6E13e-54A0A1U8H6E1_CAPAN; probable transcription factor KAN3
STRINGPGSC0003DMT4000164642e-41(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-19G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang C, et al.
    Involvement of OsSPX1 in phosphate homeostasis in rice.
    Plant J., 2009. 57(5): p. 895-904
    [PMID:19000161]
  3. Zhang Q,Wang C,Tian J,Li K,Shou H
    Identification of rice purple acid phosphatases related to phosphate starvation signalling.
    Plant Biol (Stuttg), 2011. 13(1): p. 7-15
    [PMID:21143719]
  4. Wu Z,Ren H,McGrath SP,Wu P,Zhao FJ
    Investigating the contribution of the phosphate transport pathway to arsenic accumulation in rice.
    Plant Physiol., 2011. 157(1): p. 498-508
    [PMID:21715673]
  5. Chen J, et al.
    OsPHF1 regulates the plasma membrane localization of low- and high-affinity inorganic phosphate transporters and determines inorganic phosphate uptake and translocation in rice.
    Plant Physiol., 2011. 157(1): p. 269-78
    [PMID:21753117]
  6. Wang C, et al.
    Functional characterization of the rice SPX-MFS family reveals a key role of OsSPX-MFS1 in controlling phosphate homeostasis in leaves.
    New Phytol., 2012. 196(1): p. 139-48
    [PMID:22803610]
  7. Tian J, et al.
    Overexpression of OsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice.
    J Integr Plant Biol, 2012. 54(9): p. 631-9
    [PMID:22805094]
  8. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  9. Wu P,Shou H,Xu G,Lian X
    Improvement of phosphorus efficiency in rice on the basis of understanding phosphate signaling and homeostasis.
    Curr. Opin. Plant Biol., 2013. 16(2): p. 205-12
    [PMID:23566853]
  10. Wang S, et al.
    Auxin response factor (OsARF12), a novel regulator for phosphate homeostasis in rice (Oryza sativa).
    New Phytol., 2014. 201(1): p. 91-103
    [PMID:24111723]
  11. Shi J, et al.
    The paralogous SPX3 and SPX5 genes redundantly modulate Pi homeostasis in rice.
    J. Exp. Bot., 2014. 65(3): p. 859-70
    [PMID:24368504]
  12. Li S,Wang C,Zhou L,Shou H
    Oxygen deficit alleviates phosphate overaccumulation toxicity in OsPHR2 overexpression plants.
    J. Plant Res., 2014. 127(3): p. 433-40
    [PMID:24687599]
  13. Zhou Z, et al.
    SPX proteins regulate Pi homeostasis and signaling in different subcellular level.
    Plant Signal Behav, 2015. 10(9): p. e1061163
    [PMID:26224365]
  14. Zhang K, et al.
    Down-regulation of OsSPX1 caused semi-male sterility, resulting in reduction of grain yield in rice.
    Plant Biotechnol. J., 2016. 14(8): p. 1661-72
    [PMID:26806409]
  15. Cao Y, et al.
    Identification and expression analysis of OsLPR family revealed the potential roles of OsLPR3 and 5 in maintaining phosphate homeostasis in rice.
    BMC Plant Biol., 2016. 16(1): p. 210
    [PMID:27716044]