PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04105.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 303aa    MW: 33762.7 Da    PI: 8.3291
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04105.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.12.1e-17224258135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              Cs+Cg+  Tp+WR gp g+ktLCnaCG+++++ +l
  Sme2.5_04105.1_g00002.1 224 CSHCGVQRTPQWRTGPMGTKTLCNACGVRFKSGRL 258
                              *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.1E-7112297IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.688218254IPR000679Zinc finger, GATA-type
SMARTSM004011.3E-15218272IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-14220281No hitNo description
Gene3DG3DSA:3.30.50.102.2E-14222256IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.15E-13223271No hitNo description
PROSITE patternPS003440224249IPR000679Zinc finger, GATA-type
PfamPF003202.2E-15224258IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MLYRTTTPHS SSSSSSSSSL QALEMIHQHS SVDEFFVDNL LDLSNGFYED EIEQFDEHPN  60
GFNGEKPCSV SPQKKMEAEI EKLDDEKPCS VSTQKKMEAE NEDLGYELSF RENGLDNLEW  120
LSQFVEEDSC SGYSLMTGKL PENKNQSATE KKKIHVQGKS CFPGPVQTKP RTQRGRIGGR  180
VWSLTGSSTS SASSSTTTTT AESVVRLNKR RKTMAEKPVQ PRRCSHCGVQ RTPQWRTGPM  240
GTKTLCNACG VRFKSGRLLP EYRPACSPTF SSERHSNSHR KVLEMRQKKE AGTGGLAPPV  300
HSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343381.21e-134PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH578e-50GATA5_ARATH; GATA transcription factor 5
TrEMBLM1DH951e-134M1DH95_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000890181e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.16e-49GATA transcription factor 7