PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04025.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 201aa    MW: 22851.6 Da    PI: 8.2779
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04025.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.97.6e-20112146135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              C++C +tkTp+WR+gp g+ktLCnaCG++yr+ +l
  Sme2.5_04025.1_g00004.1 112 CTHCDVTKTPQWREGPLGPKTLCNACGVRYRSGRL 146
                              *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-14106156IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.345110142IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-15111169No hitNo description
CDDcd002028.41E-15111160No hitNo description
Gene3DG3DSA:3.30.50.102.8E-14111143IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.1E-17112146IPR000679Zinc finger, GATA-type
PROSITE patternPS003440112137IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MDEDFENIFN GLDFLAEPEK VGKDWDAVAT HEEWQHSDSM LSYQSPISVL DAISFQFGSK  60
GRRSKRARSS TFNPWLLMPP IPNTTSTDNN SSDAKSGKEN KRKSNCSLFK KCTHCDVTKT  120
PQWREGPLGP KTLCNACGVR YRSGRLLPEY RPAASPTFIP SLHSNSNRKV VEMRRKTVEE  180
SPECDSQKFA PLPSYWFDTY C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242094.28e-87PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP83e-39GAT11_ARATH; GATA transcription factor 11
TrEMBLK4C9N09e-87K4C9N0_SOLLC; Uncharacterized protein
STRINGSolyc06g075140.2.12e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31342149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-39GATA transcription factor 11