PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03673.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 301aa    MW: 33104.3 Da    PI: 5.8392
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03673.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.22.1e-3449103155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYR+
  Sme2.5_03673.1_g00003.1  49 KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRM 103
                              79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.17646106IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-3347104IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-2449104IPR006447Myb domain, plants
SuperFamilySSF466893.05E-1749105IPR009057Homeodomain-like
PfamPF002497.6E-951102IPR001005SANT/Myb domain
PfamPF143798.3E-25147193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MYSTLPIRNL GIEESGDFFN HHINLQSSLS VDGTNLPGDS CLVLSADPKP RLRWTTELHE  60
RFVDAVTQLG GPDKATPKTI MRTMGVKGLT LYHLKSHLQK YRMGKQSAKE ATENSKDVSC  120
PAESQDTGSS TSGSSRVIAQ DIYEGLQVTE ALRVQMEVQR RLQEQLEVQR HLQLRIEAQE  180
KYLQSILEKA CKAFSSQSVE SNGLEVNREE LSELAFVSVP SLPDIDSSIE KKNACHVPAR  240
LGDCLLDDCL PSNGIGALKK RPRAFSTVNG LPMESNTREL GLVDGDEIDA MLHQGGGGYG  300
H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-2049105157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-2049105157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-2049105157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-2049105157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754483e-74HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755213e-74HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006366846.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ8LAJ71e-103PHL3_ARATH; Protein PHR1-LIKE 3
SwissprotQ94A571e-103PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A0V0I1960.0A0A0V0I196_SOLCH; Putative myb family transcription factor APL-like
STRINGPGSC0003DMT4000803810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-82G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]