PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03554.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 578aa    MW: 65616.5 Da    PI: 5.7415
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03554.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.37.3e-942085761374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalk 82 
                              lv+lLl++Ae v++++++ a++ +ar  ++as +g+p+qRl +yf eAL++r+ r   e+ ++  + e + +        ++    
  Sme2.5_03554.1_g00002.1 208 LVHLLLAAAEEVDQQQFHSASQSIARCLQNASVTGNPIQRLCFYFGEALQERIDR---EIGRSP-CFERKLRFlstlALGTTPEAL 289
                              68*****************************************************...333222.222221111111222222234 PP

                     GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLak 167
                              +++   P+ ++ +++ NqaI+e v+g+ ++H +Df+i  G+Q   L+qaL++R+  +   l+iT++g+   ++ke++eetg+rL++
  Sme2.5_03554.1_g00002.1 290 TYHTEIPFCQVLQFAGNQAIVENVKGAIKIHLVDFNIRSGIQCTGLMQALSERRdCPIELLKITAIGH---QEKEKIEETGKRLQS 372
                              488899*********************************************999345569********...579************ PP

                     GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                              fA++l++pf+f+++  ++++dl++e+ +vk +Ea+aV +   l ++     + +++ d++++++++l+P vvvv e ea+hns+sF
  Sme2.5_03554.1_g00002.1 373 FANSLNLPFSFDMVFISDMKDLKVESVNVKADEAVAVYCYAVLRTMI----CRQDYLDNTMRVIRGLRPSVVVVHEVEANHNSPSF 454
                              *****************************************999998....77778888*************************** PP

                     GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                              l+rf+eal +ys+lfd++e  + r++  r+ +E + +g+ i+n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l
  Sme2.5_03554.1_g00002.1 455 LNRFVEALFFYSVLFDCFEDCMDRDNLVRKRIEVFHIGEGIRNMVAAEGAERFTRNVKLDVWRAYFARFGMVEMELSESSRYQANL 540
                              ************************************************************************************** PP

                     GRAS 340 llrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              +l++++ +   +v+++ ++l+ gWk+ p+ svS W+
  Sme2.5_03554.1_g00002.1 541 ILKQFShGSSCTVQNDGKALLVGWKGTPIESVSIWK 576
                              ******8888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.547182555IPR005202Transcription factor GRAS
PfamPF035142.5E-91208576IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MDQVSFPTNG FIVFQDGHNH LQECRRNELI NNGIVDPWFE VNREDTAFHL KYQENPSDKQ  60
VQLLEDQQQN ISDHWTQSDD SSNMHLLLQP IQIQTIPGSS SGVQPQLPRL DNFHKEKTNS  120
ISLASLELLN SCGRLFNKSS EENLSIVLSN KARGSDIPKL STEEILQVAG ERYIQYSTQR  180
VDGLSVFVHP YASSLSGLSI EQTKDMELVH LLLAAAEEVD QQQFHSASQS IARCLQNASV  240
TGNPIQRLCF YFGEALQERI DREIGRSPCF ERKLRFLSTL ALGTTPEALT YHTEIPFCQV  300
LQFAGNQAIV ENVKGAIKIH LVDFNIRSGI QCTGLMQALS ERRDCPIELL KITAIGHQEK  360
EKIEETGKRL QSFANSLNLP FSFDMVFISD MKDLKVESVN VKADEAVAVY CYAVLRTMIC  420
RQDYLDNTMR VIRGLRPSVV VVHEVEANHN SPSFLNRFVE ALFFYSVLFD CFEDCMDRDN  480
LVRKRIEVFH IGEGIRNMVA AEGAERFTRN VKLDVWRAYF ARFGMVEMEL SESSRYQANL  540
ILKQFSHGSS CTVQNDGKAL LVGWKGTPIE SVSIWKLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4422757622375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355859.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AB560.0M1AB56_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000187920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-41RGA-like 1