PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03099.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 734aa    MW: 83064.8 Da    PI: 6.2751
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03099.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM67.34.5e-216723298
                      NAM 32 evikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98
                             ++i+e+d+yk++Pw Lp+kv  +ekewyfF +rd+ky++g+r+nr+++sgyWka g+dk+++s++++
  Sme2.5_03099.1_g00001.1  6 QIIAEIDLYKFDPWVLPSKVIFGEKEWYFFNPRDRKYPNGSRPNRVANSGYWKANGTDKAITSEGKK 72
                             679**************888889***************************************95444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100524.0441126IPR003441NAC domain
SuperFamilySSF1019417.72E-26384IPR003441NAC domain
SuperFamilySSF566721.11E-12153236No hitNo description
SuperFamilySSF566728.75E-5416466No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
GDFSLQIIAE IDLYKFDPWV LPSKVIFGEK EWYFFNPRDR KYPNGSRPNR VANSGYWKAN  60
GTDKAITSEG KKLDDWVLCR IYKRNPNVQK TCSSDLPSKE ISHGSSLPLS SQFEDNEDVI  120
AEVRQELVCG RVIIYCISIN QDDSKEGQVY IVGEGEESFQ TLKDRLTSAP VLTLPERLDG  180
IVVYCDTTRF GFVCVLMLHG KVIDYVPRQL KVHQRNYPAY DLELAAVKWE DVNIDFVVGL  240
PRIRKHLDSI WSIIDQTTKL AHFLSGETTL SVEDNVELCN LELASREDNS NAGRHVEVLN  300
VGIQGIEVGE NLSYEEALVE ILDGQVERIR KEDQHVESGI KLGRREHHMD RVAPHGLFIG  360
PFGGLCENIL SVGPRPKFPE SLSKCGFTGR VRHATSSRVL FMGVKHATSM EGLDGIVVYC  420
DAAQFGLRCI LMQHGKVIAY VPRQLKVHNH NYSARDLEFA AMKKEYVNMD FVVRLPRTQK  480
QLDSIWSIVD RMTRSAHFLS SETTLNVKDN AELCNLELVY VKVSPMEGVM DFGKKGKFKF  540
SVSKLRKLVG DTSANVPLEC VEVRENLSYE EVPVEFLDGL VERLRNEDQH VKSAMWEVGS  600
SIMQRYLYPF HSTQDYDIRA RMNKFMLAIS DLVNEECHTT ILVCEMDLSQ LMTYAGQLEG  660
EKIRKRRSGE SKNAQIENGS SFDVALRPKF QKDGVTSPKY QGDSVGGQTP PTCVEGTIRE  720
IVSPVPVHFL GMVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-4029043171NO APICAL MERISTEM PROTEIN
1ut4_B1e-4029043171NO APICAL MERISTEM PROTEIN
1ut7_A1e-4029043171NO APICAL MERISTEM PROTEIN
1ut7_B1e-4029043171NO APICAL MERISTEM PROTEIN
3swm_A2e-4029046174NAC domain-containing protein 19
3swm_B2e-4029046174NAC domain-containing protein 19
3swm_C2e-4029046174NAC domain-containing protein 19
3swm_D2e-4029046174NAC domain-containing protein 19
3swp_A2e-4029046174NAC domain-containing protein 19
3swp_B2e-4029046174NAC domain-containing protein 19
3swp_C2e-4029046174NAC domain-containing protein 19
3swp_D2e-4029046174NAC domain-containing protein 19
4dul_A1e-4029043171NAC domain-containing protein 19
4dul_B1e-4029043171NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.16e-43NAC domain containing protein 3