PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03023.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 597aa    MW: 67972.1 Da    PI: 4.867
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03023.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.41.1e-922185881374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn......sseelaa 80 
                              lv+lLl++Ae v++++l+la++l++r    as++g+p+qRl +yf++AL++r+ r    l    ++++++++       s  + +a
  Sme2.5_03023.1_g00005.1 218 LVRLLLAAAEEVNNQQLHLARKLISRCMWVASNSGTPVQRLSFYFAKALEERIDR----LTGRYKCKDEDRHLlyikimSPGTNSA 299
                              689****************************************************....666667777776664444433333344 PP

                     GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerL 165
                              +   +++ P+ ++ +++  q+Ile v +++++H iDf+i  G+QW+ L+qaL+++  ++   l+iT+vgs   ++ke++e tg+ L
  Sme2.5_03023.1_g00005.1 300 FLSCHQLIPFNQVMQFAGVQTILENVRSAKKIHLIDFNIRSGIQWIVLIQALTEKGdRPIELLKITAVGS---TEKENIELTGNTL 382
                              44489************************************************998455559********...58*********** PP

                     GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse 251
                              ++fA++lg+pf+f+++ +++++d++ e+ ++k++E++aV +   l ++l ++ +l++    ++k+v+s++P+v+vv e ea+hns+
  Sme2.5_03023.1_g00005.1 383 HSFAKSLGLPFSFDIVFVSDMKDFKEESVNIKTDETVAVYCNSILRTMLLRPDCLDN----FMKVVRSIQPTVIVVGEVEANHNSP 464
                              ************************************************977776666....************************* PP

                     GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                              sFl+rf+e+l +ysa+fd++e  + r++  r+++E++++g+ i+n+va+eg++r+ r+ +le Wr  + ++G+ + +lse+a  qa
  Sme2.5_03023.1_g00005.1 465 SFLNRFTETLFFYSAFFDCFEDCMDRANPCRMTIEEMYFGEGIRNIVAAEGEDRFTRNVKLEVWRVFFARFGMVEEELSESAWYQA 550
                              ************************************************************************************** PP

                     GRAS 338 klllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              +l+l++++ +   +++++ + l++gWk+ p+ s+S W+
  Sme2.5_03023.1_g00005.1 551 HLILKQFAqGSSCNLHKDGKGLIIGWKGTPIHSLSIWT 588
                              ********87889999*********************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.336192567IPR005202Transcription factor GRAS
PfamPF035143.9E-90218588IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MANTSISNDN FSDFQDDQFH LKGYERSELV ENGVEDPWFL HKDCVDIDSL YSMCGLNNEE  60
NTSDEQVRTN LLEDQQPSIS DWMQNDFPTN AVMPLQPVKI QSTTEAPKND DFQPQVQEPG  120
NSSNEKPKLF PLASLELLNN HGRLSTKSSE ENLSTNGLSC EARLGNSHNL PMEEILRFAG  180
ERYIQYSTQR LDGLSMFIHP YGSALSGLCM EETRDVELVR LLLAAAEEVN NQQLHLARKL  240
ISRCMWVASN SGTPVQRLSF YFAKALEERI DRLTGRYKCK DEDRHLLYIK IMSPGTNSAF  300
LSCHQLIPFN QVMQFAGVQT ILENVRSAKK IHLIDFNIRS GIQWIVLIQA LTEKGDRPIE  360
LLKITAVGST EKENIELTGN TLHSFAKSLG LPFSFDIVFV SDMKDFKEES VNIKTDETVA  420
VYCNSILRTM LLRPDCLDNF MKVVRSIQPT VIVVGEVEAN HNSPSFLNRF TETLFFYSAF  480
FDCFEDCMDR ANPCRMTIEE MYFGEGIRNI VAAEGEDRFT RNVKLEVWRV FFARFGMVEE  540
ELSESAWYQA HLILKQFAQG SSCNLHKDGK GLIIGWKGTP IHSLSIWTFL QGNNLPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3923658721374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0AC238918.11 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349181.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AI730.0M1AI73_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-52RGA-like 1