PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02845.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 223aa    MW: 25707.8 Da    PI: 9.4071
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02845.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.4e-3155108255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrWtpeLH +Fv+a+++LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Sme2.5_02845.1_g00006.1  55 PRLRWTPELHLSFVSAIDRLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 108
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.97951111IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2851109IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1453109IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2255110IPR006447Myb domain, plants
PfamPF002491.1E-856107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MTSESIDLNE EVGDEEVIEV TSDESEKIRE ENNSTSCGNY SSTKKVRQYV RSKLPRLRWT  60
PELHLSFVSA IDRLGGQERA TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK LGEFGQVLGH  120
GHRTNQGRSY LYGKLSQRLF NPLQDFKMKN GAIVLARNFN DGDDNINNNF QNSFARSRHE  180
TKENFSSMNM DNSQREIVHQ TVRKGQLDPL PQRSQMRESW ESC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-1956110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1956110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1956110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1956110357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755154e-54HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234092.11e-105uncharacterized protein LOC101251954
TrEMBLK4BE381e-104K4BE38_SOLLC; Uncharacterized protein
TrEMBLM0ZZ731e-104M0ZZ73_SOLTU; Uncharacterized protein
STRINGSolyc03g006150.2.11e-104(Solanum lycopersicum)
STRINGPGSC0003DMT4000112071e-105(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-38G2-like family protein