PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02793.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 302aa    MW: 33233.8 Da    PI: 8.3458
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02793.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96e-402686262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             k+++++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknkkss
  Sme2.5_02793.1_g00001.1 26 KDQIVNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNKKSS 86
                             7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-301984IPR003851Zinc finger, Dof-type
PfamPF027017.2E-342784IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9293084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEEIIAKTNG SSKPNCVERK LVRPQKDQIV NCPRCNSTNT KFCYYNNYSL SQPRYFCKTC  60
RRYWTEGGSL RNIPVGGGSR KNKKSSLSSP YNSINHGIVN NPLKKLPDLV APLPQRDVIE  120
EYPERHFENR PDQNPSKIIH EGSQDLNLGF SSDFKTITEL IQVPNYDGNN KDNNSPTIST  180
LPPPPSSSSS ASSPSQLSAM ELINGITSRG WNNNSFMTMP NSVYNSSGFS LMPSLNFSLD  240
HGLGNNNNLQ ETNTSGSFLF PFVGLKQVSS TNNNTSEGAN DPLGDQSTNG YWNGMLGGGG  300
SW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755201e-146HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344006.11e-162PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLM1AWI31e-162M1AWI3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319281e-161(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.49e-45Dof family protein