PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02785.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 405aa    MW: 44995.3 Da    PI: 7.8982
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02785.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.94.8e-33261316156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Sme2.5_02785.1_g00003.1 261 KQRRCWSPELHRRFVDALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 316
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.158258318IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-30259320IPR009057Homeodomain-like
SuperFamilySSF466892.69E-18259319IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-27261316IPR006447Myb domain, plants
PfamPF002495.0E-8263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGSIPAELSL DCRPSFIPKS ITDFLQQLSL IPNVPDKLSQ IDDYITRLED EMRKIDAFKR  60
ELPLSILLVK DAIVALREES TQYRKSRTEP VLEEFIPLKK SSHEDTKAEI TKDKDSREKM  120
SWMSSVQLWN SESHCQNTDE PTSKLPSKSE LKVDNQRSPE EGNSSVTEDP FQSCKIMNMG  180
KAFSVPFKGF SGFSVTAVRK DKDELPGLSL HTPGITKLRE DTVTSALNSK HNGSRGGLSR  240
VAGCQSNIRT GSLSQQQSAR KQRRCWSPEL HRRFVDALQQ LGGSQVATPK QIRELMQVDG  300
LTNDEVKSHL QKYRLHTRRI PNSQTQPANQ SGVSLGNLWM SQGQYGESSK QSSSQSGSPQ  360
GPLHLGGSCG GTSTTVGDSM EEDDDVKSEN HSWKNHVHAS GKIDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-145HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230796.10.0myb family transcription factor isoform X1
TrEMBLA0A0V0I6V00.0A0A0V0I6V0_SOLCH; Putative two-component response regulator-like APRR2-like
STRINGSolyc01g108300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.18e-57G2-like family protein