PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02703.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 363aa    MW: 41234.9 Da    PI: 5.6544
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02703.1_g00004.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.5e-30207261155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rW+++LH+rF+e+v++LGG++kAtPk+il+lm++++Ltl+hvkSHLQkYR 
  Sme2.5_02703.1_g00004.1 207 KTRIRWSEDLHDRFLECVNHLGGADKATPKQILNLMDLESLTLDHVKSHLQKYRN 261
                              68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.543204264IPR017930Myb domain
SuperFamilySSF466892.15E-16205261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-27205262IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-25207262IPR006447Myb domain, plants
PfamPF002491.5E-6211260IPR001005SANT/Myb domain
PfamPF143795.3E-18289336IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MSIQRFISTQ NNEYFSTDYN FEFPKSSVQD LVDQQLQYSS SSSMISCIGS PSSAFFATER  60
CLGLTQYDVN EDSTSQLIKN YDLQMSSFDP QQCKNGTLED SLAQSEPDFR YKISLPSFIR  120
TEFSTSPFSD VSESEKESLL HLQNELLGEL DTSYRKHPSL PFDGYRDYSL SRDLCCSKLA  180
NMRQQSASPS VSCHNSASSG ASNKPSKTRI RWSEDLHDRF LECVNHLGGA DKATPKQILN  240
LMDLESLTLD HVKSHLQKYR NAKHPESAGK SEKRNSQDAV TDIDSRTGIE IKDALKMQLE  300
AQRCLHEQLE AQRMLQMRIE EQAKKLKMIF DQQQKTNRTL LKTRNSNISS PGVEILVVED  360
SND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-18207264158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-18207264158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-18207264158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-18207264158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-18207264259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-121HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055275.10.0uncharacterized protein LOC107001828
TrEMBLM1C6J90.0M1C6J9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000608550.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.18e-57G2-like family protein