PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02640.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 177aa    MW: 20357.9 Da    PI: 7.698
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02640.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.91.7e-261164154
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                             k+rl+Wt++LH+ F +av+qLGG+e+AtPk il++m+++gLt+ hvkSHLQ  R
  Sme2.5_02640.1_g00006.1 11 KERLKWTKDLHDLFEKAVSQLGGPERATPKGILKVMGIPGLTIFHVKSHLQVQR 64
                             68*************************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.532868IPR017930Myb domain
SuperFamilySSF466895.73E-14964IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-24965IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-211165IPR006447Myb domain, plants
PfamPF002496.7E-81362IPR001005SANT/Myb domain
PfamPF143791.2E-75985IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MDSNRSDSSS KERLKWTKDL HDLFEKAVSQ LGGPERATPK GILKVMGIPG LTIFHVKSHL  60
QVQRNLKMKL EAQGRFLDRI MEEQKAHASG SRPSCKSYSY SPLSLPSLCE ESESNIKELE  120
VDKLDRKRTR FEEDDAFLNH RYNNNNNVTY SPEELAWSTL ATYQSSPHLH ALYDYLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-191069160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755214e-50HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019071061.25e-86myb family transcription factor PHL7-like
TrEMBLM1C4774e-81M1C477_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000594007e-82(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-22G2-like family protein