PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02639.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 247aa    MW: 28262.5 Da    PI: 9.6575
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02639.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM94.22.1e-2968054128
                      NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              ++kewyfFs r +ky+++ r+nr+t sg+Wkatg dk+v+s+++e +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  Sme2.5_02639.1_g00008.1   6 DSKEWYFFSMRGRKYKNSVRPNRVTGSGFWKATGIDKPVYSQSNECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 80 
                              568**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.7021114IPR003441NAC domain
SuperFamilySSF1019411.1E-315113IPR003441NAC domain
PfamPF023652.5E-12980IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSKVGDSKEW YFFSMRGRKY KNSVRPNRVT GSGFWKATGI DKPVYSQSNE CIGLKKSLVY  60
YRGSAGKGTK TDWMMHEFRL PPIWKATSNG QMLPNPKNIA PEAEVWTLCR IFKRTSNYKR  120
FTSDWKQQHQ SVVKQSFGDT SSKACSLQSE ISDDHSNNME FPQKNINNAS SGGNLNYQLD  180
QRNSYYYNNS QPIATMPQLS FTSSSNSSFW NTSTAEDQEY LFSDGNWDEL KSVVDLAIDP  240
RSLFGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-30812071171NO APICAL MERISTEM PROTEIN
1ut4_B4e-30812071171NO APICAL MERISTEM PROTEIN
1ut7_A4e-30812071171NO APICAL MERISTEM PROTEIN
1ut7_B4e-30812071171NO APICAL MERISTEM PROTEIN
4dul_A4e-30812071171NAC domain-containing protein 19
4dul_B4e-30812071171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755191e-102HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006367842.21e-146PREDICTED: transcription factor JUNGBRUNNEN 1-like isoform X1
RefseqXP_016580368.11e-146PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A1U8HGS61e-145A0A1U8HGS6_CAPAN; transcription factor JUNGBRUNNEN 1-like
TrEMBLM1BNA91e-145M1BNA9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000491241e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-55NAC domain containing protein 42