PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02584.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 360aa    MW: 39038.7 Da    PI: 7.4758
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02584.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-392585262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ke+al+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  Sme2.5_02584.1_g00003.1 25 KEQALNCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 85
                             67999*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-332783IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-252879IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4222983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MMSQDNKDES QSSGGGGGST TVRPKEQALN CPRCDSPNTK FCYYNNYSLS QPRHFCKTCR  60
RYWTKGGALR NVPIGGGCRK NKKIKTSSSS SRFSGDSKDT IGGSSDIGGL KFLHGLSPAM  120
DFQLGGLSFP RLSNSSTSVG GSIFNQYSSF GENSAANIGS TSCFSLDPSG SCSGSLLGFN  180
NNFSFSSSML KQGTDGIQEM GSMGVHHGTM ASSIESLSSI NQDLHWKLQQ QRLAMLFGGE  240
NQKENIVSSS IPLHDDQNQI QIQKPQPILF QNLEISSSKQ QEHHQEAFGS NNINSRKDCS  300
TTTTTHGNNL ATEWFFDNSF GVNPSSTNSD NGNANEDQNG NNWNTTIQAW SNLNQYSTLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755231e-126HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250167.10.0dof zinc finger protein DOF5.7
TrEMBLA0A2G2VDA50.0A0A2G2VDA5_CAPBA; Dof zinc finger protein DOF5.3
STRINGSolyc11g010940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-49Dof family protein