PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02561.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 288aa    MW: 32114.5 Da    PI: 8.0894
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02561.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.21.7e-3270125359
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                               vrYkeClkNhAas+Gg+a+DGCgEfmps geegt++al C+AC+CHRnFHR+e e 
  Sme2.5_02561.1_g00001.1  70 IVRYKECLKNHAASMGGNATDGCGEFMPS-GEEGTIEALICSACNCHRNFHRKEIEG 125
                              68**************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2571132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-2971123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-3172123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.36673122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.607.6E-30211277IPR009057Homeodomain-like
SuperFamilySSF466893.59E-18213276IPR009057Homeodomain-like
TIGRFAMsTIGR015652.4E-26215271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MELPSQDEDM PIPINSTYVG GGHGHGHMIH HDPTPPNNTN HIVPPSMNGP PIDAPPVAAA  60
ADHHVPFKKI VRYKECLKNH AASMGGNATD GCGEFMPSGE EGTIEALICS ACNCHRNFHR  120
KEIEGDLQQL QLPSSCDCFH HHNRGGSAKK LYLGHNKSNT LLGPEPFGTI IPTRPIPPHH  180
QMIMSYNMGS LPNSESEEHD GVGIMAMARP LHHVKKRFRT KFTQEQKDKM LNFAEKVGWK  240
IQKQEEAVVQ QFCQDVGVKR RVLKVWMHNN KHSLAKKNSN NIPNENQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242162731875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754408e-96HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755138e-96HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230410.11e-178zinc-finger homeodomain protein 4
SwissprotQ9M9S03e-78ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A3Q7EPX11e-177A0A3Q7EPX1_SOLLC; Uncharacterized protein
STRINGSolyc01g102980.2.11e-177(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-78homeobox protein 31