PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02470.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 161aa    MW: 19034.6 Da    PI: 7.6561
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02470.1_g00007.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM93.43.8e-29988181
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81
                             lppGfrFhPtdeel+++yL+ +++++++++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra+ sg
  Sme2.5_02470.1_g00007.1  9 LPPGFRFHPTDEELIMYYLRYQATSRPFPI-SIIPEIDVYKFDPWELPEKAEFGENEWYFFTPRDRKYPNGVRPNRAAVSG 88
                             79****************************.89***************99999***********************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-475132IPR003441NAC domain
PROSITE profilePS5100529.8419147IPR003441NAC domain
PfamPF023651.2E-1110105IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MVGKINSDLP PGFRFHPTDE ELIMYYLRYQ ATSRPFPISI IPEIDVYKFD PWELPEKAEF  60
GENEWYFFTP RDRKYPNGVR PNRAAVSGKP PKGVKTDWIM HEYRLSDSKS QNTKQSGSMR  120
LDDWVLCRIY KKKNLGKTIE MMKVEEEEDV KAHQTERDSS H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-53813414170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0918741e-104EF091874.1 Solanum tuberosum NAC domain protein NAC2 (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074984.16e-98NAC domain-containing protein 1
SwissprotK4BWV24e-98NAP1_SOLLC; NAC domain-containing protein 1
TrEMBLA0A1U8EJR94e-96A0A1U8EJR9_CAPAN; NAC transcription factor
TrEMBLA0A2G2VLL01e-96A0A2G2VLL0_CAPBA; NAC transcription factor
TrEMBLA0A2G2XY284e-96A0A2G2XY28_CAPAN; NAC transcription factor 29-like
TrEMBLA0A2G3B7M03e-96A0A2G3B7M0_CAPCH; NAC transcription factor 29
STRINGSolyc05g007770.2.12e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-74NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]